Antimicrobial Peptide Research
LL-37
5mgBuy LL-37 peptide from UK stock, sent the same day you order. One 5mg freeze-dried vial, for laboratory research only.
Chemical identity: PubChem CID 16198951
Vial size
Quantity
Handling
LL-37 storage
- Sealed vial
- -20°CProtect from light
- Before opening
- Room temperatureStops condensation getting in
- Once reconstituted
- 2–8°CUse within 28 days
- Shipping
- Tracked 24Royal Mail, dispatched the same day
The range
One vial, or the set.
Every vial in the range is lyophilised, labelled and lot-numbered the same way, with the certificate for its lot linked from its own product page. Pictured: BPC-157, TB-500, GHK-Cu, Glow and Retatrutide.
Browse the rangeLL-37 UK: common questions
- What's the LL-37 price?
- £29.99 for one 5mg vial. Two vials are £53.98, three are £71.98 and five are £104.97, which is 10%, 20% and 30% off. Every vial ships from our Manchester stock on the day you order.
- Is this the full 37-residue LL-37 sequence?
- Yes. It is the complete 37-residue human cathelicidin fragment, [LL-37, 37 aa], with a molecular weight of 4,493.0 Da and PubChem CID 16198951. It is not the hCAP18 precursor and not a shortened fragment such as KR-12.
- How fast is delivery?
- Same day, from Manchester, whenever you order. Royal Mail Tracked 24 aims for next working day delivery. Free over £40, otherwise £3.99.
- What else do I need with LL-37?
- Bacteriostatic water, to dissolve the freeze-dried powder. We stock it, and you can add it from the Storage section above.
- How should I store LL-37?
- Sealed vial: -20°C, away from light. Once reconstituted: 2-8°C, use within 28 days, and don't refreeze.
- Can I buy LL-37 in the UK?
- Yes, for laboratory research. LL-37 isn't a controlled drug in the UK and has no UK licence as a medicine, so it's sold for research use only, not for human use. It is not on the WADA Prohibited List. You must be 18 or over.
About the LL-37 peptide
LL-37 is a 37-residue peptide that starts with two leucines, [LL-37, 37 aa] It is cut from the C-terminus of hCAP18, the single human cathelicidin encoded by the CAMP gene, and was first characterised by Gudmundsson and Agerberth in Stockholm in the mid 1990s. It folds into a cationic amphipathic helix and is studied in membrane and innate immunity models. We sell it as freeze-dried powder in a 5mg vial, for laboratory research only.
Research areas
- Antimicrobial peptide membrane models
- Innate immunity signalling
- Biofilm assays
- Wound model studies
LL-37 in the research literature
The human cathelicidin was first found as a cDNA from bone marrow: Agerberth and colleagues, 1995, named the predicted peptide FALL-39 after its first four residues and showed it was cysteine-free. Gudmundsson and colleagues, 1996, then isolated the processed form from granulocytes and found it two residues shorter, LL-37, which is why both names survive. Johansson and colleagues, 1998, tied its antibacterial activity to conformation. Sørensen and colleagues, 2001, identified proteinase 3 as the enzyme that cuts LL-37 from hCAP18 outside the cell. Wang and colleagues, 2008, solved its structure in lipid micelles and defined KR-12 as the smallest active fragment.
The Dürr 2006 review covers membrane models, biofilm assays and receptor work. Kahlenberg and colleagues, 2013, present the other side, reviewing LL-37 as a driver of inflammation and autoimmune disease, so the literature is not one-directional.
LL-37 vs KPV: which to order
LL-37 and KPV come from different parents. LL-37 is the 37-residue C-terminal fragment of human cathelicidin hCAP18, 4,493.0 Da, cationic and helical, PubChem CID 16198951. KPV is Lys-Pro-Val, the three C-terminal residues of alpha-MSH, 342.4 Da, PubChem CID 125672, studied through melanocortin pathways rather than membrane disruption. Pick LL-37 for cathelicidin, membrane or biofilm work and KPV for alpha-MSH fragment work. Neither has a UK licence; LL-37's INN ropocamptide reached phase II and stopped.
The label shows LL-37 and 5mg, and the lab report, once published on this page, will show the measured mass against 4,493.0 Da, separating full-length LL-37 from fragments such as KR-12. One size, with packs at 10, 20 and 30% off. Buy LL-37 UK stock and it leaves Manchester the same day, with free UK delivery over £40.
Every batch tested by an independent laboratory before dispatch. The signed certificate for this lot is published on this page.
Legal notice
This product is sold strictly for in-vitro laboratory research purposes only. It is not approved for human or veterinary use, is not a drug, food, or cosmetic, and should not be misused as such. UK Peptides accepts no liability for misuse. By purchasing you confirm you are a qualified researcher aged 18 or over.
LL-37 5mg
£29.99